PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000319700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 1577aa    MW: 176253 Da    PI: 6.4052
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000319700genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY67.61.8e-21221267147
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTE CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkv 47 
                    ldDg++WrKYGqK vk++ +prsYYrCt+++C+vkk+ er+ + +++
  MDP0000319700 221 LDDGFRWRKYGQKAVKNTLCPRSYYRCTHNTCSVKKQNERAWSKTSI 267
                    59**************************************9877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-20207267IPR003657WRKY domain
SuperFamilySSF1182902.09E-18213266IPR003657WRKY domain
PROSITE profilePS5081119.164216261IPR003657WRKY domain
SMARTSM007744.6E-18221271IPR003657WRKY domain
PfamPF031061.8E-16222263IPR003657WRKY domain
PfamPF047622.5E-19254370IPR006849Elongator complex subunit Iki3
SuperFamilySSF693222.09E-12278510No hitNo description
Gene3DG3DSA:2.130.10.101.0E-5313349IPR015943WD40/YVTN repeat-like-containing domain
PfamPF047622.5E-1803901114IPR006849Elongator complex subunit Iki3
Gene3DG3DSA:2.130.10.101.0E-5420600IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF693222.09E-12556617No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002098Biological ProcesstRNA wobble uridine modification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0033588Cellular ComponentElongator holoenzyme complex
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1577 aa     Download sequence    Send to blast
MAKSMRCKRE KRLRAIRREM VEPYYDKKDE AKLAAQEAAL AAPKLPVRPP PKSTSAMEVS  60
TTNGASASTS NMDVDMDAVN ERIAALKPAG GGSKLLMPFD GPVCSTSSSS PTYQFPPQNN  120
LFTPSSSSLS INLFDNPHSP PDPHHHQVQI PPDIDWISLL SGDQPAGDLL TTHNNHDQAG  180
DRAEEIRGSN RRKGGGSSRN YTRRSSRPRV AFHTRSTDXI LDDGFRWRKY GQKAVKNTLC  240
PRSYYRCTHN TCSVKKQNER AWSKTSISAQ VNQIELDPKD FITSFSYLME KEALLVGTGN  300
GLLLLHSVXV NATQVVGGVD GGVKCIAPSP DGDLLAITTG SGQVLVMTQD WDLLYETALE  360
DLPEDGNHVN SNYLLSSHLK ALFXGXVMGI VDWMPSGAKI AAVYDRKSEN ECPSIVFFER  420
NGLERNLFSI NEQTNATIEF LKWNCSSDLL AAVVRCENYD CVKVWYFSNN HWYLKSEIRY  480
PRQDGVRFVW NPTKSLQLLC WTLGGQITSY DFIWNSAVMD DSTALVIDDS KILVTPLSLY  540
IMPPPMYLFS LKFLSAVRDF AFYSKNSRNC LAAFLSDGSL CVVELPATDT WEELEGKEFA  600
AEASISESPF GSFLHMTWLD PHKILAVSHY GFSHSNYLSQ TTSSEDGAGF YLQEVELVCS  660
ENHVPGLVTC SGWHAKVAGQ NSLEEMIISI APNPARKGSA FVQFDGGKVC EYVPKFGIPR  720
GVPKXDWSFS STCPSMSVVL VGNSGXLEPL IFGLDESCRL HVNGKIICNN CXSFSXYSNL  780
DDQVITHIVL ATKQDCLFIA DITDIFHREL EIKYEKPIQA GNKKREDHGD FINIWERGAK  840
VVGVLHGDEA AVILQTTRGN LESMYPRKLV LASICNALVQ RXFRDALLMV RRHRIDFNVI  900
VDYCGWQVFL QSASEFVKQV NNLNYITEFV CAINNENIIE TLYKKFISLP FPKEAKDDSK  960
GFDSNNKIPS VLLAIRKALE EHSPEVPARE LCILTTLARS DPPALDEALE RIKAIREMEL  1020
SGSNDQRRMS YPSAEEALKH LLXLSDSESV YEAALGLYDL NLAAMVALNS QRDPKEFLPF  1080
LQQLESMPVT LMRYNIDLRL HRFEKALKHI VSAGDACYSD SLNLMRKNPQ LFPLGHQLIA  1140
NPAKKKQVLE AWGDYLSGEK CFDDAAATYL CCSSLEKALK SYRACGNWSK VLTVAGLLKL  1200
SEDEIMQMAH ELCEELQALG KPREAAKIAL EYCGDVNNGM NLLISARDWE EALRVALMHN  1260
RQDLVSDVKN ASLECASLLI GEYEEGLEKV GKYLARYLAL RQRRLLLAAK IXSEEXSMDD  1320
LDDDTASEAS SNFSGMSAYT TGTRGSSGTS TRSRAASKAR DARRQRKRGK IRPGSPGEEL  1380
ALADHLKGMS LTTGALQELK SLLLSLXMLG EVEIARKLQR AGENLQLSHM AAVKLTEDTI  1440
SSDNTDEHTQ TLDHYTQIIR SEVQNSEAFF WRCKPLFQTT RAGKSIYYRC YWVHITICEI  1500
GSGNDGVRPR LVSGVWGLGF WEMEARKLLN DKKFWVASFL IAWAAALQGH MMWVQRQESF  1560
KQKFGSLRET ETSDAEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5cqr_A4e-6485914274555Elongator complex protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.7811e-129bud| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337589.10.0PREDICTED: elongator complex protein 1-like isoform X1
SwissprotQ9FNA40.0ELP1_ARATH; Elongator complex protein 1
TrEMBLM5X7Q70.0M5X7Q7_PRUPE; Elongator complex protein 1
STRINGVIT_13s0019g00590.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.18e-23WRKY DNA-binding protein 43